Structure of PDB 3adi Chain A Binding Site BS02

Receptor Information
>3adi Chain A (length=71) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPG
FFNRKAAEQSAAEVALRELAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3adi Structure of arabidopsis HYPONASTIC LEAVES1 and its molecular implications for miRNA processing
Resolution3.2 Å
Binding residue
(original residue number in PDB)		H43 F47 F65 N66 R67
Binding residue
(residue number reindexed from 1)		H30 F34 F52 N53 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003725 double-stranded RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3adi, PDBe:3adi, PDBj:3adi
PDBsum3adi
PubMed20462493
UniProtO04492|DRB1_ARATH Double-stranded RNA-binding protein 1 (Gene Name=DRB1)

[Back to BioLiP]