Structure of PDB 2z34 Chain A Binding Site BS02

Receptor Information
>2z34 Chain A (length=155) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIVNILSVNVLNNPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQ
SYDQILDTLLVGPIPIGINKFVFEADPPNIDLLPQLSDVLGVTVILLSCA
YEDNEFVRVGYYVNNEMEGLNLQEMIKKVKVDISKVWRSILAEKPRVTRF
NIQWD
Ligand information
>2z34 Chain D (length=22) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QKVTITKEGKKRVAPQLLTTLS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z34 Crystal structures of fission yeast histone chaperone Asf1 complexed with the Hip1 B-domain or the Cac2 C terminus
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S36 D37 E39 L61 E103 D104
Binding residue
(residue number reindexed from 1)		S35 D36 E38 L60 E102 D103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z34, PDBe:2z34, PDBj:2z34
PDBsum2z34
PubMed18334479
UniProtO74515|ASF1_SCHPO Histone chaperone cia1 (Gene Name=cia1)

[Back to BioLiP]