Structure of PDB 2z2p Chain A Binding Site BS02

Receptor Information
>2z2p Chain A (length=293) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFKLQELNLTNQDTGPYGITVSDKGKVWITQHKANMISCINLDGKITEYE
LPNKGAKVMCLTISSDGEVWFTENAANKIGRITKKGIIKEYTLPNPDSAP
YGITEGPNGDIWFTEMNGNRIGRITDDGKIREYELPNKGSYPSFITLGSD
NALWFTENQNNAIGRITESGDITEFKIPTPASGPVGITKGNDDALWFVEI
IGNKIGRITTSGEITEFKIPTPNARPHAITAGAGIDLWFTEWGANKIGRL
TSNNIIEEYPIQIKSAEPAGICFDGETIWFAMECDKIGKLTLI
Ligand information
>2z2p Chain D (length=8) Species: 68212 (Streptomyces graminofaciens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TTPPFMIt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z2p Structural Basis for Streptogramin B Resistance in Staphylococcus Aureus by Virginiamycin B Lyase
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D24 S66 N152
Binding residue
(residue number reindexed from 1)		D23 S65 N151
Enzymatic activity
Enzyme Commision number 4.2.99.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0016829 lyase activity
GO:0016835 carbon-oxygen lyase activity
GO:0046872 metal ion binding
Biological Process
GO:0017001 antibiotic catabolic process
GO:0046677 response to antibiotic
Cellular Component
GO:0030288 outer membrane-bounded periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2z2p, PDBe:2z2p, PDBj:2z2p
PDBsum2z2p
PubMed17563376
UniProtP17978|VGB_STAAU Virginiamycin B lyase (Gene Name=vgb)

[Back to BioLiP]