Structure of PDB 2ypt Chain A Binding Site BS02

Receptor Information
>2ypt Chain A (length=424) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHV
PPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYL
WRLSGRPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQT
LGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSL
VLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSK
RSSHSNAYFYGFKRIVLFDTLLEQGCKNEEVLAVLGHALGHWKLGHTVKN
IIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSP
YNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVS
DWLFSMWHYSHPPLLERLQALKTM
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain2ypt Chain A Residue 600 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypt The Structural Basis of Zmpste24-Dependent Laminopathies.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		H335 H339 E415
Binding residue
(residue number reindexed from 1)		H287 H291 E367
Annotation score4
Enzymatic activity
Enzyme Commision number 3.4.24.84: Ste24 endopeptidase.
Gene Ontology
Molecular Function
GO:0003690 double-stranded DNA binding
GO:0004175 endopeptidase activity
GO:0004222 metalloendopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008235 metalloexopeptidase activity
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0001889 liver development
GO:0001942 hair follicle development
GO:0003007 heart morphogenesis
GO:0003229 ventricular cardiac muscle tissue development
GO:0003231 cardiac ventricle development
GO:0003417 growth plate cartilage development
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
GO:0006508 proteolysis
GO:0006925 inflammatory cell apoptotic process
GO:0006974 DNA damage response
GO:0006997 nucleus organization
GO:0006998 nuclear envelope organization
GO:0007346 regulation of mitotic cell cycle
GO:0007628 adult walking behavior
GO:0008016 regulation of heart contraction
GO:0008340 determination of adult lifespan
GO:0008360 regulation of cell shape
GO:0008544 epidermis development
GO:0010506 regulation of autophagy
GO:0010628 positive regulation of gene expression
GO:0010629 negative regulation of gene expression
GO:0010906 regulation of glucose metabolic process
GO:0016485 protein processing
GO:0019216 regulation of lipid metabolic process
GO:0030282 bone mineralization
GO:0030327 prenylated protein catabolic process
GO:0030500 regulation of bone mineralization
GO:0032006 regulation of TOR signaling
GO:0032350 regulation of hormone metabolic process
GO:0035264 multicellular organism growth
GO:0040014 regulation of multicellular organism growth
GO:0040029 epigenetic regulation of gene expression
GO:0043007 maintenance of rDNA
GO:0043516 regulation of DNA damage response, signal transduction by p53 class mediator
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0044255 cellular lipid metabolic process
GO:0048145 regulation of fibroblast proliferation
GO:0048538 thymus development
GO:0050688 regulation of defense response to virus
GO:0050905 neuromuscular process
GO:0051276 chromosome organization
GO:0051604 protein maturation
GO:0055013 cardiac muscle cell development
GO:0060307 regulation of ventricular cardiac muscle cell membrane repolarization
GO:0060993 kidney morphogenesis
GO:0061337 cardiac conduction
GO:0061762 CAMKK-AMPK signaling cascade
GO:0070302 regulation of stress-activated protein kinase signaling cascade
GO:0071480 cellular response to gamma radiation
GO:0071586 CAAX-box protein processing
GO:0072423 response to DNA damage checkpoint signaling
GO:1903463 regulation of mitotic cell cycle DNA replication
GO:1903522 regulation of blood circulation
GO:1903799 negative regulation of miRNA processing
GO:1990036 calcium ion import into sarcoplasmic reticulum
GO:2000730 regulation of termination of RNA polymerase I transcription
GO:2000772 regulation of cellular senescence
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005637 nuclear inner membrane
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0031901 early endosome membrane
GO:0031902 late endosome membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ypt, PDBe:2ypt, PDBj:2ypt
PDBsum2ypt
PubMed23539603
UniProtO75844|FACE1_HUMAN CAAX prenyl protease 1 homolog (Gene Name=ZMPSTE24)

[Back to BioLiP]