Structure of PDB 2ypb Chain A Binding Site BS02

Receptor Information
>2ypb Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILR
LAMKYINFLAKLLNDQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypb Structural Basis for Lmo2-Driven Recruitment of the Scl:E47bHLH Heterodimer to Hematopoietic-Specific Transcriptional Targets.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		R195 E196 R199
Binding residue
(residue number reindexed from 1)		R15 E16 R19
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046983 protein dimerization activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ypb, PDBe:2ypb, PDBj:2ypb
PDBsum2ypb
PubMed23831025
UniProtP17542|TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 (Gene Name=TAL1)

[Back to BioLiP]