Structure of PDB 2ypa Chain A Binding Site BS02

Receptor Information
>2ypa Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRL
AMKYINFLAKLLNDQEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypa Structural Basis for Lmo2-Driven Recruitment of the Scl:E47bHLH Heterodimer to Hematopoietic-Specific Transcriptional Targets.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R195 E196 R199
Binding residue
(residue number reindexed from 1)		R14 E15 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046983 protein dimerization activity
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ypa, PDBe:2ypa, PDBj:2ypa
PDBsum2ypa
PubMed23831025
UniProtP17542|TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 (Gene Name=TAL1)

[Back to BioLiP]