Structure of PDB 2ygv Chain A Binding Site BS02

Receptor Information
>2ygv Chain A (length=154) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSL
DHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSY
DGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNI
VWDN
Ligand information
>2ygv Chain H (length=10) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VKRAKLDQFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ygv Surprising Complexity of the Asf1 Histone Chaperone-Rad53 Kinase Interaction
Resolution2.94 Å
Binding residue
(original residue number in PDB)		L6 L7 G8 I9 K10 P15 A141 E142 P144
Binding residue
(residue number reindexed from 1)		L5 L6 G7 I8 K9 P14 A140 E141 P143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ygv, PDBe:2ygv, PDBj:2ygv
PDBsum2ygv
PubMed22323608
UniProtP32447|ASF1_YEAST Histone chaperone ASF1 (Gene Name=ASF1)

[Back to BioLiP]