Structure of PDB 2xma Chain A Binding Site BS02

Receptor Information
>2xma Chain A (length=139) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMTYVILPLEMKKGRGYVYQLEYHLIWCVKYRHQVLVGEVADGLKDIL
RDIAAQNGLEVITMEVMPDHVHLLLSATPQQAIPDFVKALKGASARRMFV
AYPQLKEKLWGGNLWNPSYCILTVSENTRAQIQKYIESQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xma DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K12 R14 Y16 V17
Binding residue
(residue number reindexed from 1)		K15 R17 Y19 V20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006310 DNA recombination
GO:0006313 DNA transposition
GO:0032196 transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xma, PDBe:2xma, PDBj:2xma
PDBsum2xma
PubMed20890269
UniProtQ7DF83|DRA2A_DEIRA ISDra2 transposase TnpA (Gene Name=tnpA)

[Back to BioLiP]