Structure of PDB 2x6v Chain A Binding Site BS02

Receptor Information

>2x6v Chain A (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYIL
LMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQL
VSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADTAFCTHVFPETAF
IAVTSYQNHKITQLKIENNPFAKGFRG

Ligand information

>2x6v Chain D (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

taaggtgtgag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2x6v Structural Basis of Tbx5-DNA Recognition: The T-Box Domain in its DNA-Bound and -Unbound Form.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R81 R82 K159 Y217 T223 K226 I227 N230 F232 F236
Binding residue (residue number reindexed from 1)	R29 R30 K107 Y156 T162 K165 I166 N169 F171 F175
Binding affinity	PDBbind-CN: Kd=109nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2x6v, PDBe:2x6v, PDBj:2x6v
PDBsum	2x6v
PubMed	20450920
UniProt	Q99593\|TBX5_HUMAN T-box transcription factor TBX5 (Gene Name=TBX5)

[Back to BioLiP]