Structure of PDB 2wuc Chain A Binding Site BS02

Receptor Information
>2wuc Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDS
VSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKG
DRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREA
LVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKN
GVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wuc Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H57 S99 D189 A190 C191 Q192 S195 S214 W215 G216 D217
Binding residue
(residue number reindexed from 1)		H40 S87 D185 A186 C187 Q188 S191 S210 W211 G212 D213
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H40 D90 Q188 G189 D190 S191 G192
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wuc, PDBe:2wuc, PDBj:2wuc
PDBsum2wuc
PubMed20004165
UniProtQ04756|HGFA_HUMAN Hepatocyte growth factor activator (Gene Name=HGFAC)

[Back to BioLiP]