Structure of PDB 2wkp Chain A Binding Site BS02

Receptor Information
>2wkp Chain A (length=320) Species: 4498,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFL
QGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQK
GDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVG
DGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
LEDYDRLRPLSYPQTDVFLICFSLVSPASFHHVRAKWYPEVRHHCPNTPI
ILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSAL
TQRGLKTVFDEAIRAVLCPP
Ligand information
Ligand IDFMN
InChIInChI=1S/C17H21N4O9P/c1-7-3-9-10(4-8(7)2)21(15-13(18-9)16(25)20-17(26)19-15)5-11(22)14(24)12(23)6-30-31(27,28)29/h3-4,11-12,14,22-24H,5-6H2,1-2H3,(H,20,25,26)(H2,27,28,29)/t11-,12+,14-/m0/s1
InChIKeyFVTCRASFADXXNN-SCRDCRAPSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.7.6Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)CC(C(C(COP(=O)(O)O)O)O)O
OpenEye OEToolkits 1.7.6Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C[C@@H]([C@@H]([C@@H](COP(=O)(O)O)O)O)O
ACDLabs 12.01N=2C(=O)NC(=O)C3=Nc1cc(C)c(C)cc1N(C=23)CC(O)C(O)C(O)COP(=O)(O)O
CACTVS 3.385Cc1cc2N=C3C(=O)NC(=O)N=C3N(C[CH](O)[CH](O)[CH](O)CO[P](O)(O)=O)c2cc1C
CACTVS 3.385Cc1cc2N=C3C(=O)NC(=O)N=C3N(C[C@H](O)[C@H](O)[C@H](O)CO[P](O)(O)=O)c2cc1C
FormulaC17 H21 N4 O9 P
NameFLAVIN MONONUCLEOTIDE;
RIBOFLAVIN MONOPHOSPHATE
ChEMBLCHEMBL1201794
DrugBankDB03247
ZINCZINC000003831425
PDB chain2wkp Chain A Residue 1725 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wkp A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
T418 N449 C450 R451 L453 Q454 V463 I470 N482 N492 F494 L496 F509 G511 Q513
Binding residue
(residue number reindexed from 1)
T15 N46 C47 R48 L50 Q51 V60 I67 N79 N89 F91 L93 F106 G108 Q110
Annotation score1
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019899 enzyme binding
GO:0019901 protein kinase binding
GO:0031996 thioesterase binding
GO:0044877 protein-containing complex binding
GO:0051022 Rho GDP-dissociation inhibitor binding
Biological Process
GO:0001764 neuron migration
GO:0001934 positive regulation of protein phosphorylation
GO:0003376 sphingosine-1-phosphate receptor signaling pathway
GO:0006954 inflammatory response
GO:0007015 actin filament organization
GO:0007155 cell adhesion
GO:0007160 cell-matrix adhesion
GO:0007163 establishment or maintenance of cell polarity
GO:0007264 small GTPase-mediated signal transduction
GO:0008045 motor neuron axon guidance
GO:0008360 regulation of cell shape
GO:0008361 regulation of cell size
GO:0009611 response to wounding
GO:0009653 anatomical structure morphogenesis
GO:0010310 regulation of hydrogen peroxide metabolic process
GO:0010591 regulation of lamellipodium assembly
GO:0010592 positive regulation of lamellipodium assembly
GO:0010595 positive regulation of endothelial cell migration
GO:0010764 negative regulation of fibroblast migration
GO:0010811 positive regulation of cell-substrate adhesion
GO:0016477 cell migration
GO:0016601 Rac protein signal transduction
GO:0030031 cell projection assembly
GO:0030032 lamellipodium assembly
GO:0030036 actin cytoskeleton organization
GO:0030041 actin filament polymerization
GO:0030334 regulation of cell migration
GO:0030865 cortical cytoskeleton organization
GO:0031116 positive regulation of microtubule polymerization
GO:0031529 ruffle organization
GO:0032707 negative regulation of interleukin-23 production
GO:0032956 regulation of actin cytoskeleton organization
GO:0034446 substrate adhesion-dependent cell spreading
GO:0035025 positive regulation of Rho protein signal transduction
GO:0035556 intracellular signal transduction
GO:0043652 engulfment of apoptotic cell
GO:0045428 regulation of nitric oxide biosynthetic process
GO:0045730 respiratory burst
GO:0048012 hepatocyte growth factor receptor signaling pathway
GO:0048261 negative regulation of receptor-mediated endocytosis
GO:0048870 cell motility
GO:0051492 regulation of stress fiber assembly
GO:0051496 positive regulation of stress fiber assembly
GO:0051668 localization within membrane
GO:0051894 positive regulation of focal adhesion assembly
GO:0060071 Wnt signaling pathway, planar cell polarity pathway
GO:0060263 regulation of respiratory burst
GO:0060326 cell chemotaxis
GO:0071526 semaphorin-plexin signaling pathway
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097178 ruffle assembly
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1902622 regulation of neutrophil migration
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005884 actin filament
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0005938 cell cortex
GO:0016020 membrane
GO:0030027 lamellipodium
GO:0030425 dendrite
GO:0030667 secretory granule membrane
GO:0031410 cytoplasmic vesicle
GO:0032587 ruffle membrane
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0042470 melanosome
GO:0042995 cell projection
GO:0043020 NADPH oxidase complex
GO:0043197 dendritic spine
GO:0045202 synapse
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2wkp, PDBe:2wkp, PDBj:2wkp
PDBsum2wkp
PubMed19693014
UniProtO49003;
P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 (Gene Name=RAC1)

[Back to BioLiP]