Structure of PDB 2wbu Chain A Binding Site BS02

Receptor Information
>2wbu Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELT
RHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wbu The Structure of the Klf4 DNA-Binding Domain Links to Self-Renewal and Macrophage Differentiation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
S415 Y430 D445 S472
Binding residue
(residue number reindexed from 1)
S17 Y32 D47 S74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wbu, PDBe:2wbu, PDBj:2wbu
PDBsum2wbu
PubMed21290164
UniProtQ60793|KLF4_MOUSE Krueppel-like factor 4 (Gene Name=Klf4)

[Back to BioLiP]