Structure of PDB 2w6w Chain A Binding Site BS02

Receptor Information

>2w6w Chain A (length=153) Species: 9755 (Physeter catodon)

VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLK
TEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIP
IKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG
YQG

Ligand information

• Ligand ID: XE
• InChI: InChI=1S/Xe
• InChIKey: FHNFHKCVQCLJFQ-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Xe]
• Formula: Xe
• Name: XENON
• ChEMBL: CHEMBL1236802
• DrugBank: DB13453
• PDB chain: 2w6w Chain A Residue 1157

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2w6w Pattern of Cavities in Globins: The Case of Human Hemoglobin.
• Resolution: 1.99 Å
• Binding residue (original residue number in PDB): G25 I28 L29 G65 V68 L69
• Binding residue (residue number reindexed from 1): G25 I28 L29 G65 V68 L69
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.11.1.-
  1.7.-.-

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0019430 removal of superoxide radicals

Cellular Component

• GO:0005737 cytoplasm
• GO:0016528 sarcoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:2w6w, PDBe:2w6w, PDBj:2w6w
• PDBsum: 2w6w
• PubMed: 19365817
• UniProt: P02185|MYG_PHYMC Myoglobin (Gene Name=MB)