Structure of PDB 2vs8 Chain A Binding Site BS02

Receptor Information
>2vs8 Chain A (length=183) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAP
LMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMR
EQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLD
DHRHGVYVLNISLRDRIKFVHTILSSHLNPLPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vs8 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G20 D21 G22 Y25 Y29 K30 R33 R37 R77
Binding residue
(residue number reindexed from 1)		G16 D17 G18 Y21 Y25 K26 R29 R33 R73
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vs8, PDBe:2vs8, PDBj:2vs8
PDBsum2vs8
PubMed18974222
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]