Structure of PDB 2vj0 Chain A Binding Site BS02

Receptor Information
>2vj0 Chain A (length=246) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYG
NKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECI
SDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQ
LSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGI
IHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vj0 Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins.
Resolution1.6 Å
Binding residue
(original residue number in PDB)
F836 F837 W840 D881 R905 E907 N909 R916
Binding residue
(residue number reindexed from 1)
F144 F145 W148 D189 R213 E215 N217 R224
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2vj0, PDBe:2vj0, PDBj:2vj0
PDBsum2vj0
PubMed17986441
UniProtP17427|AP2A2_MOUSE AP-2 complex subunit alpha-2 (Gene Name=Ap2a2)

[Back to BioLiP]