Structure of PDB 2vic Chain A Binding Site BS02

Receptor Information
>2vic Chain A (length=151) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVE
IIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKLP
TLWTNSCFISTVGGAPLNVVKQYIENQQNSNRPKQKEKWKSYVDNLQTKA
L
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vic Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		S9 N10 H11 N12 V14 L51 D72 S74 F75
Binding residue
(residue number reindexed from 1)		S5 N6 H7 N8 V10 L47 D68 S70 F71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004803 transposase activity
GO:0046872 metal ion binding
Biological Process
GO:0006313 DNA transposition

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vic, PDBe:2vic, PDBj:2vic
PDBsum2vic
PubMed18243097
UniProtQ933Z0

[Back to BioLiP]