Structure of PDB 2v2t Chain A Binding Site BS02

Receptor Information

>2v2t Chain A (length=279) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

CPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTQPAIELRD
CGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHS
FNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQ
ASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEEL
YLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEI
SEPVTVNVFLQRLTDGVCSEPLPFTYLPR

Ligand information

>2v2t Chain D (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaattccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2v2t X-Ray Structure of a NF-kappaB p50/Relb/DNA Complex Reveals Assembly of Multiple Dimers on Tandem kappaB Sites.
Resolution	3.05 Å
Binding residue (original residue number in PDB)	R117 R119 A127 G128
Binding residue (residue number reindexed from 1)	R18 R20 A28 G29

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2v2t, PDBe:2v2t, PDBj:2v2t
PDBsum	2v2t
PubMed	17869269
UniProt	Q04863\|RELB_MOUSE Transcription factor RelB (Gene Name=Relb)

[Back to BioLiP]