Structure of PDB 2uzk Chain A Binding Site BS02

Receptor Information
>2uzk Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGW
KNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2uzk Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		L180 R211 H212 S215 S232 W234 R249 S253
Binding residue
(residue number reindexed from 1)		L24 R55 H56 S59 S76 W78 R93 S97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2uzk, PDBe:2uzk, PDBj:2uzk
PDBsum2uzk
PubMed17940099
UniProtO43524|FOXO3_HUMAN Forkhead box protein O3 (Gene Name=FOXO3)

[Back to BioLiP]