Structure of PDB 2uyc Chain A Binding Site BS02

Receptor Information
>2uyc Chain A (length=327) Species: 726 (Haemophilus haemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2uyc HhaI DNA Methyltransferase R163N Mutant Complex with 13mer Gcgc-Gmgc Oligonucleotide and Sah
Resolution2.0 Å
Binding residue
(original residue number in PDB)		C81 S85 I86 S87 G88 K89 R97 E119 V121 K162 R165 R228 Q237 R240 Y242 I249 T250 S252 A253 Y254 G255 G256 N304
Binding residue
(residue number reindexed from 1)		C81 S85 I86 S87 G88 K89 R97 E119 V121 K162 R165 R228 Q237 R240 Y242 I249 T250 S252 A253 Y254 G255 G256 N304
Enzymatic activity
Catalytic site (original residue number in PDB) C81 E119 N163 R165
Catalytic site (residue number reindexed from 1) C81 E119 N163 R165
Enzyme Commision number 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003886 DNA (cytosine-5-)-methyltransferase activity
GO:0008168 methyltransferase activity
Biological Process
GO:0009307 DNA restriction-modification system
GO:0032259 methylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2uyc, PDBe:2uyc, PDBj:2uyc
PDBsum2uyc
PubMed
UniProtP05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)

[Back to BioLiP]