Structure of PDB 2stw Chain A Binding Site BS02

Receptor Information
>2stw Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPD
EVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2stw Correction of the NMR structure of the ETS1/DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		K69 K71 K78 R81 Y86
Binding residue
(residue number reindexed from 1)		K60 K62 K69 R72 Y77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2stw, PDBe:2stw, PDBj:2stw
PDBsum2stw
PubMed9460239
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]