Structure of PDB 2r5y Chain A Binding Site BS02

Receptor Information
>2r5y Chain A (length=73) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
SLTERQIKIWFQNRRMKWKKEHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r5y Functional specificity of a Hox protein mediated by the recognition of minor groove structure
Resolution2.6 Å
Binding residue
(original residue number in PDB)		V88 R105 Y125 R128 R131 Q150 R153 M154 K157
Binding residue
(residue number reindexed from 1)		V15 R17 Y37 R40 R43 Q62 R65 M66 K69
Binding affinityPDBbind-CN: Kd=10.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2r5y, PDBe:2r5y, PDBj:2r5y
PDBsum2r5y
PubMed17981120
UniProtP09077|SCR_DROME Homeotic protein Sex combs reduced (Gene Name=Scr)

[Back to BioLiP]