Structure of PDB 2qk9 Chain A Binding Site BS02

Receptor Information
>2qk9 Chain A (length=153) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQ
RAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTS
AGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQ
SED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qk9 Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution2.55 Å
Binding residue
(original residue number in PDB)		N151 G152 R179 T181 N182 Q183 F213 W221 W225 S233 V238 I239 N240
Binding residue
(residue number reindexed from 1)		N18 G19 R46 T48 N49 Q50 F80 W88 W92 S100 V105 I106 N107
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qk9, PDBe:2qk9, PDBj:2qk9
PDBsum2qk9
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]