Structure of PDB 2qhb Chain A Binding Site BS02

Receptor Information
>2qhb Chain A (length=86) Species: 35889 (Nicotiana glutinosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKW
KTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qhb Complex structure of plant telomere bindig protein, NgTRF and telomere DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R574 R575 R577 R578 H613 R614 D621
Binding residue
(residue number reindexed from 1)		R1 R2 R4 R5 H40 R41 D48
Enzymatic activity
Enzyme Commision number ?
External links