Structure of PDB 2o6m Chain A Binding Site BS02

Receptor Information
>2o6m Chain A (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASQLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2o6m Mutability of an HNH nuclease imidazole general base and exchange of a deprotonation mechanism.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		N57 R61 Q63 R74 T95 A96 S97 Q98 N119 N123
Binding residue
(residue number reindexed from 1)		N56 R60 Q62 R73 T94 A95 S96 Q97 N118 N122
Binding affinityPDBbind-CN: Kd=13nM
Enzymatic activity
Catalytic site (original residue number in PDB) N119
Catalytic site (residue number reindexed from 1) N118
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2o6m, PDBe:2o6m, PDBj:2o6m
PDBsum2o6m
PubMed17516660
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]