Structure of PDB 2ntc Chain A Binding Site BS02

Receptor Information
>2ntc Chain A (length=127) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSV
TFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYL
MYSALTRDPFSVIEESLPGGLKEHDFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ntc The Crystal Structure of the SV40 T-Antigen Origin Binding Domain in Complex with DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		S147 H148 A149 F151 S152 N153 R154 N227
Binding residue
(residue number reindexed from 1)		S16 H17 A18 F20 S21 N22 R23 N96
Binding affinityPDBbind-CN: Kd=60nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ntc, PDBe:2ntc, PDBj:2ntc
PDBsum2ntc
PubMed17253903
UniProtQ98ZP7

[Back to BioLiP]