Structure of PDB 2nqj Chain A Binding Site BS02

Receptor Information
>2nqj Chain A (length=279) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTID
EFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQ
LGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQ
GSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTF
ADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQD
DRFDGIPLILQTINPDIWAEEIAWLKAQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nqj DNA apurinic-apyrimidinic site binding and excision by endonuclease IV.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
N35 R37 Q38 W39 L73 L114 Q150 G151 S152 V228
Binding residue
(residue number reindexed from 1)
N35 R37 Q38 W39 L73 L114 Q150 G151 S152 V228
Binding affinityPDBbind-CN: Kd=114nM
Enzymatic activity
Enzyme Commision number 3.1.21.2: deoxyribonuclease IV.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004519 endonuclease activity
GO:0008081 phosphoric diester hydrolase activity
GO:0008270 zinc ion binding
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008833 deoxyribonuclease IV (phage-T4-induced) activity
GO:0016791 phosphatase activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2nqj, PDBe:2nqj, PDBj:2nqj
PDBsum2nqj
PubMed18408731
UniProtP0A6C1|END4_ECOLI Endonuclease 4 (Gene Name=nfo)

[Back to BioLiP]