Structure of PDB 2np2 Chain A Binding Site BS02

Receptor Information
>2np2 Chain A (length=102) Species: 139 (Borreliella burgdorferi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPKVTKSDIVDQIALNIKNNNLKLEKKYIRLVIDAFFEELKSNLCSNNVI
EFRSFGTFEVRKRKGRLNARNPQTGEYVKVLDHHVAYFRPGKDLKERVWG
IK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2np2 Shaping the Borrelia burgdorferi genome: crystal structure and binding properties of the DNA-bending protein Hbb.
Resolution3.02 Å
Binding residue
(original residue number in PDB)
T10 K11 R58 S59 R75 N76 P77 Q78 R94 K97
Binding residue
(residue number reindexed from 1)
T5 K6 R53 S54 R70 N71 P72 Q73 R89 K92
Binding affinityPDBbind-CN: Kd=55nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2np2, PDBe:2np2, PDBj:2np2
PDBsum2np2
PubMed17244195
UniProtQ57267|DBH_BORBU DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]