Structure of PDB 2nbj Chain A Binding Site BS02

Receptor Information
>2nbj Chain A (length=93) Species: 1434121 (Methanosarcina thermophila CHTI-55) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNTRNFVLRDEDGNEHGVFTGKQPRQAALKAANRGSGTKANPDIIRLRER
GTKKVHVFKAWKEIVDAPKNRPAWMPEKISKPFVKKERIEKLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nbj First 3D structure of an atypical protein-DNA complex
ResolutionN/A
Binding residue
(original residue number in PDB)		S1 N2 K22 Q23 R25 N70 R71 P72 W74 K81 K86 R88 I89
Binding residue
(residue number reindexed from 1)		S1 N2 K22 Q23 R25 N70 R71 P72 W74 K81 K86 R88 I89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042262 DNA protection

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2nbj, PDBe:2nbj, PDBj:2nbj
PDBsum2nbj
PubMed
UniProtP12770|HMC1_METTE Chromosomal protein MC1

[Back to BioLiP]