Structure of PDB 2mtz Chain A Binding Site BS02

Receptor Information

>2mtz Chain A (length=169) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

GRKLLTYQVKQGDTLNSIAADFRISTAALLQANPSLQAGLTAGQSIVIPG
LPDPYTIPYHIAVSIGAKTLTLSLNNRVMKTYPIAVGKILTQTPTGEFYI
INRQRNPGGPFGAYWLSLSKQHYGIHGTNNPASIGKAVSKGCIRMHNKDV
IELASIVPNGTRVTINRGS

Ligand information

>2mtz Chain G (length=4) Species: 1423 (Bacillus subtilis)

AEKA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2mtz Atomic model of a cell-wall cross-linking enzyme in complex with an intact bacterial peptidoglycan.
• Resolution: N/A
• Binding residue (original residue number in PDB): R23 Q104
• Binding residue (residue number reindexed from 1): R23 Q104

Enzymatic activity

• Enzyme Commision number: 2.-.-.-

Gene Ontology

Molecular Function

• GO:0016740 transferase activity
• GO:0016757 glycosyltransferase activity
• GO:0016787 hydrolase activity
• GO:0071972 peptidoglycan L,D-transpeptidase activity

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0018104 peptidoglycan-protein cross-linking
• GO:0030435 sporulation resulting in formation of a cellular spore
• GO:0071555 cell wall organization

Cellular Component

• GO:0031160 spore wall

External links

• PDB: RCSB:2mtz, PDBe:2mtz, PDBj:2mtz
• PDBsum: 2mtz
• PubMed: 25429710
• UniProt: O34816|YKUD_BACSU Putative L,D-transpeptidase YkuD (Gene Name=ykuD)