Structure of PDB 2mqq Chain A Binding Site BS02

Receptor Information
>2mqq Chain A (length=215) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMV
EMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSY
KDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDEL
GVKRPTSVKVFSGKSERSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPY
PYTLKLCFSTAQHAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mqq Structural Investigation of hnRNP L bound to RNA
ResolutionN/A
Binding residue
(original residue number in PDB)		R478 N479 R481 Q487 K490 R492 H501 F503 N504 K530 F532 K535 R538 Y573 K576 F579 S580 T581 A582 H584
Binding residue
(residue number reindexed from 1)		R107 N108 R110 Q116 K119 R121 H130 F132 N133 K159 F161 K164 R167 Y202 K205 F208 S209 T210 A211 H213
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mqq, PDBe:2mqq, PDBj:2mqq
PDBsum2mqq
PubMed
UniProtF1LQ48|HNRPL_RAT Heterogeneous nuclear ribonucleoprotein L (Gene Name=Hnrnpl)

[Back to BioLiP]