Structure of PDB 2me6 Chain A Binding Site BS02

Receptor Information

>2me6 Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQ
VKIWFQNRRAKWKRIKAGNVS

Ligand information

>2me6 Chain C (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgactaattagtcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2me6 NMR Structure of the homeodomain transcription factor Gbx1 from Homo sapiens in complex with the DNA sequence CGACTAATTAGTCG
Resolution	N/A
Binding residue (original residue number in PDB)	R8 R10 T12 I53 N57 K61 R64
Binding residue (residue number reindexed from 1)	R8 R10 T12 I53 N57 K61 R64

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2me6, PDBe:2me6, PDBj:2me6
PDBsum	2me6
PubMed
UniProt	Q14549\|GBX1_HUMAN Homeobox protein GBX-1 (Gene Name=GBX1)

[Back to BioLiP]