Structure of PDB 2mak Chain A Binding Site BS02

Receptor Information
>2mak Chain A (length=82) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMASSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTH
EVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKR
Ligand information
>2mak Chain D (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSELNELAEFARLQDQLDHRGDH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mak STIM1/Orai1 coiled-coil interplay in the regulation of store-operated calcium entry.
ResolutionN/A
Binding residue
(original residue number in PDB)		G-5 K366 Q372 L373 A376 K377 G379 I383 K386
Binding residue
(residue number reindexed from 1)		G1 K61 Q67 L68 A71 K72 G74 I78 K81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005246 calcium channel regulator activity

View graph for
Molecular Function
External links
PDB RCSB:2mak, PDBe:2mak, PDBj:2mak
PDBsum2mak
PubMed24351972
UniProtQ13586|STIM1_HUMAN Stromal interaction molecule 1 (Gene Name=STIM1)

[Back to BioLiP]