Structure of PDB 2m7n Chain A Binding Site BS02

Receptor Information

>2m7n Chain A (length=68) Species: 5759 (Entamoeba histolytica)

GQDLSDDKIGLKVLFKLMDVDGDGKLTKEEVTSFFKKHGIEKVAEQVMKA
DANGDGYITLEEFLEFSL

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 2m7n Chain A Residue 202

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2m7n Functional Manipulation of a Calcium-binding Protein from Entamoeba histolytica Guided by Paramagnetic NMR.
• Resolution: N/A
• Binding residue (original residue number in PDB): D117 N119 D121 Y123 E128
• Binding residue (residue number reindexed from 1): D51 N53 D55 Y57 E62
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding
• GO:0051015 actin filament binding

Biological Process

• GO:0006909 phagocytosis
• GO:0032231 regulation of actin filament bundle assembly
• GO:0045859 regulation of protein kinase activity
• GO:0050766 positive regulation of phagocytosis
• GO:1905303 positive regulation of macropinocytosis

Cellular Component

• GO:0001891 phagocytic cup
• GO:0005737 cytoplasm
• GO:0031143 pseudopodium
• GO:0042995 cell projection

External links

• PDB: RCSB:2m7n, PDBe:2m7n, PDBj:2m7n
• PDBsum: 2m7n
• PubMed: 23782698
• UniProt: P38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)