Structure of PDB 2lkx Chain A Binding Site BS02

Receptor Information

>2lkx Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVW
FKNRRAKWRKREEFIVTD

Ligand information

>2lkx Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggggattagagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2lkx Solution structure of the K50 class homeodomain PITX2 bound to DNA and implications for mutations that cause Rieger syndrome
Resolution	N/A
Binding residue (original residue number in PDB)	R2 R3 R5 Y25 M28 R31 K50 R53 R57
Binding residue (residue number reindexed from 1)	R4 R5 R7 Y27 M30 R33 K52 R55 R59
Binding affinity	PDBbind-CN: Kd=2.6nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2lkx, PDBe:2lkx, PDBj:2lkx
PDBsum	2lkx
PubMed	15895993
UniProt	Q99697\|PITX2_HUMAN Pituitary homeobox 2 (Gene Name=PITX2)

[Back to BioLiP]