Structure of PDB 2lev Chain A Binding Site BS02

Receptor Information
>2lev Chain A (length=57) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHHHHHHSMGNSSKGVYYRNEEGQTWSGVGRQPRWLKEALLNGMKKEDFL
VKDTEEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2lev Indirect DNA Readout by an H-NS Related Protein: Structure of the DNA Complex of the C-Terminal Domain of Ler.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q14 W16 S17 G20 R21 P23 W25
Binding residue
(residue number reindexed from 1)		Q24 W26 S27 G30 R31 P33 W35
Binding affinityPDBbind-CN: Kd=1.10uM
Enzymatic activity
Enzyme Commision number ?
External links