Structure of PDB 2ld5 Chain A Binding Site BS02

Receptor Information

>2ld5 Chain A (length=67) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQ
NRRVKEKKVINKLKTTS

Ligand information

>2ld5 Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gattttatttg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ld5 Structural basis for sequence specific DNA binding and protein dimerization of HOXA13.
Resolution	N/A
Binding residue (original residue number in PDB)	R8 K10 R11 P13 Y14 Q50 I53 W54 N57 K61 K64 K68
Binding residue (residue number reindexed from 1)	R2 K4 R5 P7 Y8 Q44 I47 W48 N51 K55 K58 K62
Binding affinity	PDBbind-CN: Kd=7.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2ld5, PDBe:2ld5, PDBj:2ld5
PDBsum	2ld5
PubMed	21829694
UniProt	Q62424\|HXA13_MOUSE Homeobox protein Hox-A13 (Gene Name=Hoxa13)

[Back to BioLiP]