Structure of PDB 2l1g Chain A Binding Site BS02

Receptor Information
>2l1g Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKY
SSICSEHFTPDSFKRESNNKLLKENAVPTIFLELVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2l1g RDC refined solution structure of the THAP zinc finger of THAP1 in complex with its 16bp RRM1 DNA target
ResolutionN/A
Binding residue
(original residue number in PDB)		M1 Q3 K11 F45 K46 P47 T48 Y50 S51 R65 K70
Binding residue
(residue number reindexed from 1)		M1 Q3 K11 F45 K46 P47 T48 Y50 S51 R65 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0043565 sequence-specific DNA binding

View graph for
Molecular Function
External links
PDB RCSB:2l1g, PDBe:2l1g, PDBj:2l1g
PDBsum2l1g
PubMed
UniProtQ9NVV9|THAP1_HUMAN THAP domain-containing protein 1 (Gene Name=THAP1)

[Back to BioLiP]