Structure of PDB 2ky8 Chain A Binding Site BS02

Receptor Information

>2ky8 Chain A (length=70) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLA
RYLGNAVDLSCFDFRTGKMM

Ligand information

>2ky8 Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagccgattcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ky8 Solution structure and dynamic analysis of chicken MBD2 methyl binding domain bound to a target-methylated DNA sequence.
Resolution	N/A
Binding residue (original residue number in PDB)	K32 R46
Binding residue (residue number reindexed from 1)	K30 R44
Binding affinity	PDBbind-CN: Kd=2.1uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:2ky8, PDBe:2ky8, PDBj:2ky8
PDBsum	2ky8
PubMed	21531701
UniProt	Q5EFL0

[Back to BioLiP]