Structure of PDB 2kmk Chain A Binding Site BS02

Receptor Information

>2kmk Chain A (length=82) Species: 10116 (Rattus norvegicus)

SFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTF
IHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG

Ligand information

>2kmk Chain C (length=16)

taggcagtgatttatg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2kmk Solution structure of Gfi-1 zinc domain bound to consensus DNA.
• Resolution: N/A
• Binding residue (original residue number in PDB): R13 S15 S70 S71 I74
• Binding residue (residue number reindexed from 1): R13 S15 S70 S71 I74
• Binding affinity: PDBbind-CN: Kd=0.26nM

External links

• PDB: RCSB:2kmk, PDBe:2kmk, PDBj:2kmk
• PDBsum: 2kmk
• PubMed: 20153336
• UniProt: Q07120|GFI1_RAT Zinc finger protein Gfi-1 (Gene Name=Gfi1)