Structure of PDB 2k7f Chain A Binding Site BS02

Receptor Information
>2k7f Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLESIERD
EAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDG
LLNLIRNLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k7f Structure of the DNA-bound BRCA1 C-terminal region from human replication factor C p140 and model of the protein-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		K375 Y379 R383 I414 T415 R423 G439 N440 K458
Binding residue
(residue number reindexed from 1)		K1 Y5 R9 I40 T41 R49 G65 N66 K84
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2k7f, PDBe:2k7f, PDBj:2k7f
PDBsum2k7f
PubMed20081198
UniProtP35251|RFC1_HUMAN Replication factor C subunit 1 (Gene Name=RFC1)

[Back to BioLiP]