Structure of PDB 2jp9 Chain A Binding Site BS02

Receptor Information
>2jp9 Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSR
SDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWP
SCQKKFARSDELVRHHNMH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jp9 Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
ResolutionN/A
Binding residue
(original residue number in PDB)		F7 L21 Q25 R29 T32 K35 Y37 R50 S51 D52 K55 D80 K83 S109 D110 R114
Binding residue
(residue number reindexed from 1)		F7 L21 Q25 R29 T32 K35 Y37 R50 S51 D52 K55 D80 K83 S109 D110 R114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2jp9, PDBe:2jp9, PDBj:2jp9
PDBsum2jp9
PubMed17716689
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]