Structure of PDB 2jei Chain A Binding Site BS02

Receptor Information

>2jei Chain A (length=343) Species: 273057 (Saccharolobus solfataricus P2)

HHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANY
EARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEK
IEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNK
VFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLG
INKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRI
VTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSR
GRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>2jei Chain T (length=16)

accgaatccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2jei Molecular Basis of Selectivity of Nucleoside Triphosphate Incorporation Opposite O6-Benzylguanine by Sulfolobus Solfataricus DNA Polymerase Dpo4: Steady-State and Pre-Steady-State Kinetics and X-Ray Crystallography of Correct and Incorrect Pairing.
• Resolution: 2.39 Å
• Binding residue (original residue number in PDB): V32 S34 G41 P60 E63 G218 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R336
• Binding residue (residue number reindexed from 1): V34 S36 G43 P62 E65 G220 A222 R244 K245 S246 I247 G248 R249 I250 T252 R333 R338

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2jei, PDBe:2jei, PDBj:2jei
• PDBsum: 2jei
• PubMed: 17337730
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)