Structure of PDB 2jeg Chain A Binding Site BS02

Receptor Information

>2jeg Chain A (length=342) Species: 273057 (Saccharolobus solfataricus P2)

HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYE
ARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKI
EIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKV
FAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGI
NKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>2jeg Chain T (length=17)

caccgaatccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2jeg Molecular Basis of Selectivity of Nucleoside Triphosphate Incorporation Opposite O6-Benzylguanine by Sulfolobus Solfataricus DNA Polymerase Dpo4: Steady-State and Pre-Steady-State Kinetics and X-Ray Crystallography of Correct and Incorrect Pairing.
• Resolution: 2.38 Å
• Binding residue (original residue number in PDB): V32 G41 P60 V62 G218 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332 R336
• Binding residue (residue number reindexed from 1): V33 G42 P61 V63 G219 A221 R243 K244 S245 I246 G247 R248 I249 T251 R332 R333 R337

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2jeg, PDBe:2jeg, PDBj:2jeg
• PDBsum: 2jeg
• PubMed: 17337730
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)