Structure of PDB 2j6u Chain A Binding Site BS02

Receptor Information

>2j6u Chain A (length=344) Species: 273057 (Saccharolobus solfataricus P2)

HHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATAN
YEARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSE
KIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKN
KVFAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKL
GINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGR
IVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVS
RGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>2j6u Chain T (length=17)

cacggaatccttccccc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2j6u Sulfolobus Solfataricus DNA Polymerase Dpo4 is Partially Inhibited by "Wobble" Pairing between O6- Methylguanine and Cytosine, But Accurate Bypass is Preferred.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): V35 S37 G44 P63 E222 A223 R245 K246 S247 I248 G249 R250 I251 V252 T253 L296 R334 R335 R339
• Binding residue (residue number reindexed from 1): V35 S37 G44 P63 E222 A223 R245 K246 S247 I248 G249 R250 I251 V252 T253 L296 R334 R335 R339

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2j6u, PDBe:2j6u, PDBj:2j6u
• PDBsum: 2j6u
• PubMed: 17105728
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)