Structure of PDB 2ivh Chain A Binding Site BS02

Receptor Information
>2ivh Chain A (length=124) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKK
FWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHQEKP
ISVYDMDNISVVTPKRHIDIHRGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ivh Structural Basis for Sequence-Dependent DNA Cleavage by Nonspecific Endonucleases.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K490 G536 K537 R538 I570 R574
Binding residue
(residue number reindexed from 1)		K42 G88 K89 R90 I118 R122
Enzymatic activity
Catalytic site (original residue number in PDB) R538 E542 H544 Q545 H569 H573
Catalytic site (residue number reindexed from 1) R90 E94 H96 Q97 H117 H121
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ivh, PDBe:2ivh, PDBj:2ivh
PDBsum2ivh
PubMed17175542
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]