Structure of PDB 2iv8 Chain A Binding Site BS02

Receptor Information

>2iv8 Chain A (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFA
IQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ
VAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQI
KECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELR
IQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

Ligand information

>2iv8 Chain Q (length=3) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IVF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2iv8 Role of the Ap2 Beta-Appendage Hub in Recruiting Partners for Clathrin-Coated Vesicle Assembly.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Q756 N758 A806 Y815
Binding residue (residue number reindexed from 1)	Q52 N54 A102 Y111

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006886	intracellular protein transport
GO:0016192	vesicle-mediated transport

	Cellular Component
GO:0030117	membrane coat
GO:0030131	clathrin adaptor complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2iv8, PDBe:2iv8, PDBj:2iv8
PDBsum	2iv8
PubMed	16903783
UniProt	P63010\|AP2B1_HUMAN AP-2 complex subunit beta (Gene Name=AP2B1)

[Back to BioLiP]