Structure of PDB 2it0 Chain A Binding Site BS02

Receptor Information
>2it0 Chain A (length=145) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDG
LLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEAC
RWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVASENLYF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2it0 Crystal structures, metal activation, and DNA-binding properties of two-domain IdeR from Mycobacterium tuberculosis
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T7 Q36 S37 P39 T40 R47 R50
Binding residue
(residue number reindexed from 1)		T5 Q34 S35 P37 T38 R45 R48
Binding affinityPDBbind-CN: Kd=25uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2it0, PDBe:2it0, PDBj:2it0
PDBsum2it0
PubMed17209554
UniProtP9WMH1|IDER_MYCTU Iron-dependent repressor IdeR (Gene Name=ideR)

[Back to BioLiP]