Structure of PDB 2is4 Chain A Binding Site BS02

Receptor Information
>2is4 Chain A (length=646) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE
NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRA
HHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQK
DEGLRPHHIQNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNK
PHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDTGKVMIVGDDDQSI
YGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENNNGR
LGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAECAIL
YRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIVNRND
DAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKALAGR
AASALQRFMELIDALAQETADMPLHVQTDRVIKDSGLRTMYEQEKGEKGQ
TRIENLEELVTATRQFMPLQAFLSHAALEAGETWQDAVQLMTLHSAKGLE
FPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAE
TRRLYGKEVYHRPSRFIGELPEECVEEVRLRATVSRPVSHQRMGTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2is4 UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T63 N64 H91 H95 I113 F189 Y254 W256 R355 S356 N357 M380 N412 G417 G419 R421 T422 L535 S536 T558 H560 S582 M584 Y621
Binding residue
(residue number reindexed from 1)		T63 N64 H91 H95 I113 F186 Y251 W253 R352 S353 N354 M377 N409 G414 G416 R418 T419 L523 S524 T542 H544 S566 M568 Y605
Enzymatic activity
Catalytic site (original residue number in PDB) T36 D220 Q251
Catalytic site (residue number reindexed from 1) T36 D217 Q248
Enzyme Commision number 5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0015616 DNA translocase activity
GO:0016787 hydrolase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0017116 single-stranded DNA helicase activity
GO:0042803 protein homodimerization activity
GO:0043138 3'-5' DNA helicase activity
Biological Process
GO:0000717 nucleotide-excision repair, DNA duplex unwinding
GO:0000725 recombinational repair
GO:0006260 DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0009314 response to radiation
GO:0009432 SOS response
GO:0031297 replication fork processing
GO:0032508 DNA duplex unwinding
GO:0070581 rolling circle DNA replication
GO:0070716 mismatch repair involved in maintenance of fidelity involved in DNA-dependent DNA replication
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0017117 single-stranded DNA-dependent ATP-dependent DNA helicase complex
GO:0033202 DNA helicase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2is4, PDBe:2is4, PDBj:2is4
PDBsum2is4
PubMed17190599
UniProtP03018|UVRD_ECOLI DNA helicase II (Gene Name=uvrD)

[Back to BioLiP]