Structure of PDB 2ilk Chain A Binding Site BS02

Receptor Information
>2ilk Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLED
FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRL
RRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMT
MKIRN
Ligand information
Ligand IDSO4
InChIInChI=1S/H2O4S/c1-5(2,3)4/h(H2,1,2,3,4)/p-2
InChIKeyQAOWNCQODCNURD-UHFFFAOYSA-L
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0[O-]S(=O)(=O)[O-]
CACTVS 3.341[O-][S]([O-])(=O)=O
ACDLabs 10.04[O-]S([O-])(=O)=O
FormulaO4 S
NameSULFATE ION
ChEMBL
DrugBankDB14546
ZINC
PDB chain2ilk Chain A Residue 602 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ilk Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		C12 T13 R104
Binding residue
(residue number reindexed from 1)		C7 T8 R99
Annotation score3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005141 interleukin-10 receptor binding
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0001817 regulation of cytokine production
GO:0001818 negative regulation of cytokine production
GO:0001819 positive regulation of cytokine production
GO:0001938 positive regulation of endothelial cell proliferation
GO:0002237 response to molecule of bacterial origin
GO:0002439 chronic inflammatory response to antigenic stimulus
GO:0002639 positive regulation of immunoglobulin production
GO:0002719 negative regulation of cytokine production involved in immune response
GO:0002875 negative regulation of chronic inflammatory response to antigenic stimulus
GO:0002904 positive regulation of B cell apoptotic process
GO:0006955 immune response
GO:0007253 cytoplasmic sequestering of NF-kappaB
GO:0008285 negative regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0010468 regulation of gene expression
GO:0010507 negative regulation of autophagy
GO:0014823 response to activity
GO:0014854 response to inactivity
GO:0030097 hemopoiesis
GO:0030183 B cell differentiation
GO:0030595 leukocyte chemotaxis
GO:0030886 negative regulation of myeloid dendritic cell activation
GO:0030889 negative regulation of B cell proliferation
GO:0032496 response to lipopolysaccharide
GO:0032687 negative regulation of interferon-alpha production
GO:0032689 negative regulation of type II interferon production
GO:0032692 negative regulation of interleukin-1 production
GO:0032695 negative regulation of interleukin-12 production
GO:0032701 negative regulation of interleukin-18 production
GO:0032715 negative regulation of interleukin-6 production
GO:0032717 negative regulation of interleukin-8 production
GO:0032720 negative regulation of tumor necrosis factor production
GO:0032868 response to insulin
GO:0034115 negative regulation of heterotypic cell-cell adhesion
GO:0034116 positive regulation of heterotypic cell-cell adhesion
GO:0034465 response to carbon monoxide
GO:0035729 cellular response to hepatocyte growth factor stimulus
GO:0042092 type 2 immune response
GO:0042100 B cell proliferation
GO:0042130 negative regulation of T cell proliferation
GO:0042742 defense response to bacterium
GO:0042832 defense response to protozoan
GO:0043032 positive regulation of macrophage activation
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0045191 regulation of isotype switching
GO:0045347 negative regulation of MHC class II biosynthetic process
GO:0045348 positive regulation of MHC class II biosynthetic process
GO:0045787 positive regulation of cell cycle
GO:0045893 positive regulation of DNA-templated transcription
GO:0045930 negative regulation of mitotic cell cycle
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
GO:0050728 negative regulation of inflammatory response
GO:0050807 regulation of synapse organization
GO:0051045 negative regulation of membrane protein ectodomain proteolysis
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051384 response to glucocorticoid
GO:0060302 negative regulation of cytokine activity
GO:0060670 branching involved in labyrinthine layer morphogenesis
GO:0071222 cellular response to lipopolysaccharide
GO:0071392 cellular response to estradiol stimulus
GO:0071650 negative regulation of chemokine (C-C motif) ligand 5 production
GO:0072577 endothelial cell apoptotic process
GO:0097421 liver regeneration
GO:0140105 interleukin-10-mediated signaling pathway
GO:1900100 positive regulation of plasma cell differentiation
GO:1902895 positive regulation of miRNA transcription
GO:1903034 regulation of response to wounding
GO:1903377 negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1903659 regulation of complement-dependent cytotoxicity
GO:1903672 positive regulation of sprouting angiogenesis
GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation
GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation
GO:2000273 positive regulation of signaling receptor activity
GO:2000352 negative regulation of endothelial cell apoptotic process
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ilk, PDBe:2ilk, PDBj:2ilk
PDBsum2ilk
PubMed8897595
UniProtP22301|IL10_HUMAN Interleukin-10 (Gene Name=IL10)

[Back to BioLiP]