Structure of PDB 2iie Chain A Binding Site BS02

Receptor Information
>2iie Chain A (length=204) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKA
EMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRD
KNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIEIRGFG
SFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGGSGHH
HHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iie A Divalent Metal-mediated Switch Controlling Protein-induced DNA Bending
Resolution2.41 Å
Binding residue
(original residue number in PDB)		G92 N95 K130 K166
Binding residue
(residue number reindexed from 1)		G92 N95 K130 K166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2iie, PDBe:2iie, PDBj:2iie
PDBsum2iie
PubMed17276457
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA);
P0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]